SCOP 1.59: Domain d3at1c2: 3at1 C:151-310

Lineage for d3at1c2 (3at1 C:151-310)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)

7. Species Escherichia coli [TaxId:562] [53674] (28 PDB entries)

8. Domain d3at1c2: 3at1 C:151-310 [35187]
   Other proteins in same PDB: d3at1b1, d3at1b2, d3at1d1, d3at1d2

Details for d3at1c2

PDB Entry: 3at1, 2.8 Å

PDB Description: crystal structures of phosphonoacetamide ligated t and phosphonoacetamide and malonate ligated r states of aspartate carbamoyltransferase at 2.8-angstroms resolution and neutral ph

SCOP Domain Sequences for d3at1c2:

Sequence; same for both SEQRES and ATOM records:

>d3at1c2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampeyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

Timeline for d3at1c2:

• d3at1c2 first appeared (with stable ids) in SCOP 1.55
  
• d3at1c2 appears in SCOP 1.57
  
• d3at1c2 appears in SCOP 1.61
  
• d3at1c2 appears in the current release, SCOPe 2.08