Lineage for d7at1c2 (7at1 C:151-310)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127168Fold c.78: ATC-like [53670] (2 superfamilies)
  4. 127169Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 127170Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)
  6. 127171Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)
  7. 127179Species Escherichia coli [TaxId:562] [53674] (28 PDB entries)
  8. 127279Domain d7at1c2: 7at1 C:151-310 [35179]
    Other proteins in same PDB: d7at1b1, d7at1b2, d7at1d1, d7at1d2

Details for d7at1c2

PDB Entry: 7at1 (more details), 2.8 Å

PDB Description: crystal structures of aspartate carbamoyltransferase ligated with phosphonoacetamide, malonate, and ctp or atp at 2.8-angstroms resolution and neutral p*h

SCOP Domain Sequences for d7at1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7at1c2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampeyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOP Domain Coordinates for d7at1c2:

Click to download the PDB-style file with coordinates for d7at1c2.
(The format of our PDB-style files is described here.)

Timeline for d7at1c2: