Lineage for d5xjla_ (5xjl A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2396392Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2396573Protein D1 core SNRNP protein [50184] (4 species)
  7. 2396574Species Human (Homo sapiens) [TaxId:9606] [50185] (11 PDB entries)
  8. 2396577Domain d5xjla_: 5xjl A: [351705]
    Other proteins in same PDB: d5xjlb_, d5xjle_, d5xjlf_, d5xjlg_
    automated match to d1b34a_

Details for d5xjla_

PDB Entry: 5xjl (more details), 2.5 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2 in complex with smd1/d2/f/e/g from human
PDB Compounds: (A:) Small nuclear ribonucleoprotein Sm D1

SCOPe Domain Sequences for d5xjla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xjla_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
rgnniryfilpdslpldtllv

SCOPe Domain Coordinates for d5xjla_:

Click to download the PDB-style file with coordinates for d5xjla_.
(The format of our PDB-style files is described here.)

Timeline for d5xjla_: