Lineage for d1at1c1 (1at1 C:1-150)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127168Fold c.78: ATC-like [53670] (2 superfamilies)
  4. 127169Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 127170Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)
  6. 127171Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)
  7. 127179Species Escherichia coli [TaxId:562] [53674] (28 PDB entries)
  8. 127258Domain d1at1c1: 1at1 C:1-150 [35170]
    Other proteins in same PDB: d1at1b1, d1at1b2, d1at1d1, d1at1d2

Details for d1at1c1

PDB Entry: 1at1 (more details), 2.8 Å

PDB Description: crystal structures of phosphonoacetamide ligated t and phosphonoacetamide and malonate ligated r states of aspartate carbamoyltransferase at 2.8-angstroms resolution and neutral p*h

SCOP Domain Sequences for d1at1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1at1c1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqqteg

SCOP Domain Coordinates for d1at1c1:

Click to download the PDB-style file with coordinates for d1at1c1.
(The format of our PDB-style files is described here.)

Timeline for d1at1c1: