SCOPe 2.07: Domain d5mthl1: 5mth L:1-112

Lineage for d5mthl1 (5mth L:1-112)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d5mthl1: 5mth L:1-112 [351693]
   Other proteins in same PDB: d5mthb2, d5mthl2
   automated match to d3okla1
   complexed with act, tre

Details for d5mthl1

PDB Entry: 5mth, 1.73 Å

PDB Description: structure of dc8e8 fab at ph 6.5 crystallized in spacegroup p21

PDB Compounds: (L:) antibody fab light chain

SCOPe Domain Sequences for d5mthl1:

Sequence; same for both SEQRES and ATOM records:

>d5mthl1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldik

Timeline for d5mthl1:

• d5mthl1 is new in SCOPe 2.07-stable
  
• d5mthl1 appears in the current release, SCOPe 2.08