Lineage for d5xfvb_ (5xfv B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2437126Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2437127Protein automated matches [190048] (31 species)
    not a true protein
  7. 2437397Species Trypanosoma brucei [TaxId:185431] [351520] (2 PDB entries)
  8. 2437403Domain d5xfvb_: 5xfv B: [351587]
    automated match to d2b4gb_
    complexed with fmn, mli

Details for d5xfvb_

PDB Entry: 5xfv (more details), 1.79 Å

PDB Description: crystal structures of fmn-bound form of dihydroorotate dehydrogenase from trypanosoma brucei
PDB Compounds: (B:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d5xfvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xfvb_ c.1.4.0 (B:) automated matches {Trypanosoma brucei [TaxId: 185431]}
slkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryfg
lplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitkek
gtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaav
lndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrrc
pdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgykt
ldefrgrvktm

SCOPe Domain Coordinates for d5xfvb_:

Click to download the PDB-style file with coordinates for d5xfvb_.
(The format of our PDB-style files is described here.)

Timeline for d5xfvb_: