![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) ![]() |
![]() | Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins) |
![]() | Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [53674] (28 PDB entries) |
![]() | Domain d1raea1: 1rae A:1-150 [35152] Other proteins in same PDB: d1raeb1, d1raeb2, d1raed1, d1raed2 |
PDB Entry: 1rae (more details), 2.5 Å
SCOP Domain Sequences for d1raea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1raea1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli} anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg nvpvlnagdgsnqhptqtlldlftiqetqg
Timeline for d1raea1: