Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (38 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [351401] (4 PDB entries) |
Domain d6c4pa_: 6c4p A: [351514] automated match to d5jisa_ complexed with ca, cl, edo, na, peg, pmp |
PDB Entry: 6c4p (more details), 2.3 Å
SCOPe Domain Sequences for d6c4pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c4pa_ c.79.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} eqqadsrhnvidlvgntplialkklpkalgikpqiyaklelynpggsikdriaksmveea easgrihpsrstlieptsgntgiglaligaikgyrtiitlpekmsnekvsvlkalgaeii rtptaaawdspeshigvakklekeipgavildqynnmmnpeahyfgtgreiqrqledlnl fdnlravvagagtggtisgiskylkeqndkiqivgadpfgsilaqpenlnktditdykve gigydfvpqvldrklidvwyktddkpsfkyarqlisnegvlvggssgsaftavvkycedh pelteddvivaifpdsirsyltkfvddewlkknnlwdddvlarf
Timeline for d6c4pa_: