Lineage for d6c4pa_ (6c4p A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907817Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2907818Protein automated matches [190215] (38 species)
    not a true protein
  7. 2907837Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [351401] (4 PDB entries)
  8. 2907841Domain d6c4pa_: 6c4p A: [351514]
    automated match to d5jisa_
    complexed with ca, cl, edo, na, peg, pmp

Details for d6c4pa_

PDB Entry: 6c4p (more details), 2.3 Å

PDB Description: crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the pmp complex
PDB Compounds: (A:) cystathionine beta-synthase

SCOPe Domain Sequences for d6c4pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c4pa_ c.79.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
eqqadsrhnvidlvgntplialkklpkalgikpqiyaklelynpggsikdriaksmveea
easgrihpsrstlieptsgntgiglaligaikgyrtiitlpekmsnekvsvlkalgaeii
rtptaaawdspeshigvakklekeipgavildqynnmmnpeahyfgtgreiqrqledlnl
fdnlravvagagtggtisgiskylkeqndkiqivgadpfgsilaqpenlnktditdykve
gigydfvpqvldrklidvwyktddkpsfkyarqlisnegvlvggssgsaftavvkycedh
pelteddvivaifpdsirsyltkfvddewlkknnlwdddvlarf

SCOPe Domain Coordinates for d6c4pa_:

Click to download the PDB-style file with coordinates for d6c4pa_.
(The format of our PDB-style files is described here.)

Timeline for d6c4pa_: