PDB entry 6c4p

View 6c4p on RCSB PDB site
Description: Crystal Structures of Cystathionine beta-Synthase from Saccharomyces cerevisiae: the Structure of the PMP Complex
Class: lyase
Keywords: cbs, synthase, plp, lyase
Deposited on 2018-01-12, released 2018-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cystathionine beta-synthase
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CYS4, STR4, YGR155W, G6667
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6c4pa_
  • Heterogens: PMP, CA, NA, CL, PEG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c4pA (A:)
    mgsshhhhhhssgdlvprgshmmtkseqqadsrhnvidlvgntplialkklpkalgikpq
    iyaklelynpggsikdriaksmveeaeasgrihpsrstlieptsgntgiglaligaikgy
    rtiitlpekmsnekvsvlkalgaeiirtptaaawdspeshigvakklekeipgavildqy
    nnmmnpeahyfgtgreiqrqledlnlfdnlravvagagtggtisgiskylkeqndkiqiv
    gadpfgsilaqpenlnktditdykvegigydfvpqvldrklidvwyktddkpsfkyarql
    isnegvlvggssgsaftavvkycedhpelteddvivaifpdsirsyltkfvddewlkknn
    lwdddvlarfdsskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c4pA (A:)
    eqqadsrhnvidlvgntplialkklpkalgikpqiyaklelynpggsikdriaksmveea
    easgrihpsrstlieptsgntgiglaligaikgyrtiitlpekmsnekvsvlkalgaeii
    rtptaaawdspeshigvakklekeipgavildqynnmmnpeahyfgtgreiqrqledlnl
    fdnlravvagagtggtisgiskylkeqndkiqivgadpfgsilaqpenlnktditdykve
    gigydfvpqvldrklidvwyktddkpsfkyarqlisnegvlvggssgsaftavvkycedh
    pelteddvivaifpdsirsyltkfvddewlkknnlwdddvlarf