Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) |
Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins) |
Protein automated matches [190153] (5 species) not a true protein |
Species Vibrio vulnificus [TaxId:672] [351434] (1 PDB entry) |
Domain d6czpc1: 6czp C:1-217 [351435] Other proteins in same PDB: d6czpa2, d6czpb2, d6czpc2, d6czpd2, d6czpe2, d6czpf2, d6czph2 automated match to d1icub_ complexed with cl, fmn, gol, peg, pge |
PDB Entry: 6czp (more details), 2.24 Å
SCOPe Domain Sequences for d6czpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6czpc1 d.90.1.1 (C:1-217) automated matches {Vibrio vulnificus [TaxId: 672]} mtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegkari akatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngmhag rsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefglre kgftsvvivplgyhseddfnaklpksrwsaetvftei
Timeline for d6czpc1: