PDB entry 6czp

View 6czp on RCSB PDB site
Description: 2.2 Angstrom Resolution Crystal Structure Oxygen-Insensitive NAD(P)H-dependent Nitroreductase NfsB from Vibrio vulnificus in Complex with FMN
Class: oxidoreductase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, oxygen-insensitive nitroreductase, OXIDOREDUCTASE
Deposited on 2018-04-09, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxygen-insensitive nad(p)h nitroreductase
    Species: Vibrio vulnificus [TaxId:672]
    Gene: FORC36_4330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6czpa1, d6czpa2
  • Chain 'B':
    Compound: oxygen-insensitive nad(p)h nitroreductase
    Species: Vibrio vulnificus [TaxId:672]
    Gene: FORC36_4330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6czpb1, d6czpb2
  • Chain 'C':
    Compound: oxygen-insensitive nad(p)h nitroreductase
    Species: Vibrio vulnificus [TaxId:672]
    Gene: FORC36_4330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6czpc1, d6czpc2
  • Chain 'D':
    Compound: oxygen-insensitive nad(p)h nitroreductase
    Species: Vibrio vulnificus [TaxId:672]
    Gene: FORC36_4330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6czpd1, d6czpd2
  • Chain 'E':
    Compound: oxygen-insensitive nad(p)h nitroreductase
    Species: Vibrio vulnificus [TaxId:672]
    Gene: FORC36_4330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6czpe1, d6czpe2
  • Chain 'F':
    Compound: oxygen-insensitive nad(p)h nitroreductase
    Species: Vibrio vulnificus [TaxId:672]
    Gene: FORC36_4330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6czpf1, d6czpf2
  • Chain 'G':
    Compound: oxygen-insensitive nad(p)h nitroreductase
    Species: Vibrio vulnificus [TaxId:672]
    Gene: FORC36_4330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6czpg_
  • Chain 'H':
    Compound: oxygen-insensitive nad(p)h nitroreductase
    Species: Vibrio vulnificus [TaxId:672]
    Gene: FORC36_4330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6czph1, d6czph2
  • Heterogens: FMN, GOL, PEG, CL, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6czpA (A:)
    snamtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegk
    ariakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngm
    hagrsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefg
    lrekgftsvvivplgyhseddfnaklpksrwsaetvftei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czpA (A:)
    namtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegka
    riakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngmh
    agrsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefgl
    rekgftsvvivplgyhseddfnaklpksrwsaetvftei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6czpB (B:)
    snamtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegk
    ariakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngm
    hagrsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefg
    lrekgftsvvivplgyhseddfnaklpksrwsaetvftei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czpB (B:)
    amtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegkar
    iakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngmha
    grsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefglr
    ekgftsvvivplgyhseddfnaklpksrwsaetvftei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6czpC (C:)
    snamtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegk
    ariakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngm
    hagrsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefg
    lrekgftsvvivplgyhseddfnaklpksrwsaetvftei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czpC (C:)
    namtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegka
    riakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngmh
    agrsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefgl
    rekgftsvvivplgyhseddfnaklpksrwsaetvftei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6czpD (D:)
    snamtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegk
    ariakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngm
    hagrsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefg
    lrekgftsvvivplgyhseddfnaklpksrwsaetvftei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czpD (D:)
    amtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegkar
    iakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngmha
    grsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefglr
    ekgftsvvivplgyhseddfnaklpksrwsaetvftei
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6czpE (E:)
    snamtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegk
    ariakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngm
    hagrsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefg
    lrekgftsvvivplgyhseddfnaklpksrwsaetvftei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czpE (E:)
    namtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegka
    riakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngmh
    agrsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefgl
    rekgftsvvivplgyhseddfnaklpksrwsaetvftei
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6czpF (F:)
    snamtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegk
    ariakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngm
    hagrsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefg
    lrekgftsvvivplgyhseddfnaklpksrwsaetvftei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czpF (F:)
    amtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegkar
    iakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngmha
    grsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefglr
    ekgftsvvivplgyhseddfnaklpksrwsaetvftei
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6czpG (G:)
    snamtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegk
    ariakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngm
    hagrsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefg
    lrekgftsvvivplgyhseddfnaklpksrwsaetvftei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czpG (G:)
    mtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegkari
    akatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngmhag
    rsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefglre
    kgftsvvivplgyhseddfnaklpksrwsaetvftei
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6czpH (H:)
    snamtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegk
    ariakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngm
    hagrsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefg
    lrekgftsvvivplgyhseddfnaklpksrwsaetvftei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6czpH (H:)
    amtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegkar
    iakatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngmha
    grsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefglr
    ekgftsvvivplgyhseddfnaklpksrwsaetvftei