| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (9 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries) |
| Domain d5xkfb1: 5xkf B:2-243 [351286] Other proteins in same PDB: d5xkfa2, d5xkfb2, d5xkfc2, d5xkfd2, d5xkfe_, d5xkff1, d5xkff2, d5xkff3 automated match to d4drxb1 complexed with 88u, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 5xkf (more details), 2.8 Å
SCOPe Domain Sequences for d5xkfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xkfb1 c.32.1.1 (B:2-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp
Timeline for d5xkfb1: