Lineage for d5xkfe_ (5xkf E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339704Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2339705Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2339706Protein Stathmin 4 [101496] (2 species)
  7. 2339707Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (99 PDB entries)
  8. 3051226Domain d5xkfe_: 5xkf E: [351288]
    Other proteins in same PDB: d5xkfa1, d5xkfa2, d5xkfb1, d5xkfb2, d5xkfc1, d5xkfc2, d5xkfd1, d5xkfd2, d5xkff1, d5xkff2, d5xkff3
    automated match to d4i55e_
    complexed with 88u, ca, gdp, gol, gtp, mes, mg

Details for d5xkfe_

PDB Entry: 5xkf (more details), 2.8 Å

PDB Description: crystal structure of t2r-ttl-mpc6827 complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5xkfe_:

Sequence, based on SEQRES records: (download)

>d5xkfe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5xkfe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d5xkfe_:

Click to download the PDB-style file with coordinates for d5xkfe_.
(The format of our PDB-style files is described here.)

Timeline for d5xkfe_:

  • d5xkfe_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-19