Lineage for d1rafa2 (1raf A:151-310)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies) Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) 
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins) 
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species) Species Escherichia coli [TaxId:562] [53674] (28 PDB entries) 
Domain d1rafa2: 1raf A:151-310 [35125]
Other proteins in same PDB: d1rafb1, d1rafb2, d1rafd1, d1rafd2
Details for d1rafa2
PDB Entry: 1raf (more details), 2.5 Å
PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity
SCOP Domain Sequences for d1rafa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rafa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl
SCOP Domain Coordinates for d1rafa2:
Click to download the PDB-style file with coordinates for d1rafa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rafa2:
View in 3D
