Lineage for d1rafd1 (1raf D:1-100)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80113Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 80114Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 80115Protein Aspartate carbamoyltransferase [54895] (1 species)
  7. 80116Species Escherichia coli [TaxId:562] [54896] (26 PDB entries)
  8. 80128Domain d1rafd1: 1raf D:1-100 [39032]
    Other proteins in same PDB: d1rafa1, d1rafa2, d1rafb2, d1rafc1, d1rafc2, d1rafd2

Details for d1rafd1

PDB Entry: 1raf (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1rafd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rafd1 d.58.2.1 (D:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1rafd1:

Click to download the PDB-style file with coordinates for d1rafd1.
(The format of our PDB-style files is described here.)

Timeline for d1rafd1: