SCOPe 2.08: Domain d6g8ra2: 6g8r A:134-242

Lineage for d6g8ra2 (6g8r A:134-242)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6g8ra2: 6g8r A:134-242 [351243]
   automated match to d1f3rb2
   complexed with edo, zn

Details for d6g8ra2

PDB Entry: 6g8r, 2.74 Å

PDB Description: sp140 phd-bromodomain complex with scfv

PDB Compounds: (A:) single-chain variable fragment

SCOPe Domain Sequences for d6g8ra2:

Sequence; same for both SEQRES and ATOM records:

>d6g8ra2 b.1.1.0 (A:134-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdiqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvp
srfsgsgsgtdftltisslqpedfatyycqqssslftfgqgtkleikrt

Timeline for d6g8ra2:

• d6g8ra2 first appeared in SCOPe 2.07