PDB entry 6g8r

View 6g8r on RCSB PDB site
Description: SP140 PHD-Bromodomain complex with scFv
Class: peptide binding protein
Keywords: Epigenetics PHD Bromodomain Short-chain variable fragment, Structural Genomics, Structural Genomics Consortium, SGC, PEPTIDE BINDING PROTEIN
Deposited on 2018-04-09, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: short-chain variable fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6G8R (0-End)
    Domains in SCOPe 2.07: d6g8ra1, d6g8ra2
  • Chain 'B':
    Compound: Nuclear body protein SP140
    Species: Homo sapiens [TaxId:9606]
    Gene: SP140, LYSP100
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13342 (1-176)
      • expression tag (0)
  • Heterogens: EDO, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g8rA (A:)
    evqllesggglvqpggslrlscaasgftfygsgmgwvrqapgkglewvssiysgsgstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycartsiyyyymdywgqgtlvtvssg
    gggsggggsggggsdiqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapkl
    liyaasslqsgvpsrfsgsgsgtdftltisslqpedfatyycqqssslftfgqgtkleik
    rtaenlyfqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g8rA (A:)
    evqllesggglvqpggslrlscaasgftfygsgmgwvrqapgkglewvssiysgsgstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycartsiyyyymdywgqgtlvtvssd
    iqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqssslftfgqgtkleikrt
    

  • Chain 'B':
    No sequence available.