Lineage for d6fmkg_ (6fmk G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2538361Protein Elongin B [54246] (2 species)
  7. 2538362Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries)
  8. 2538505Domain d6fmkg_: 6fmk G: [350871]
    Other proteins in same PDB: d6fmkb1, d6fmkb2, d6fmkc_, d6fmke1, d6fmke2, d6fmkf_, d6fmkh1, d6fmkh2, d6fmki_, d6fmkk1, d6fmkk2, d6fmkl_
    automated match to d1lqba_
    complexed with dv8

Details for d6fmkg_

PDB Entry: 6fmk (more details), 2.75 Å

PDB Description: pvhl:elob:eloc in complex with n-((s)-1-((2s,4r)-4-hydroxy-2-((4-(4- methylthiazol-5-yl)benzyl)carbamothioyl) pyrrolidin-1-yl)-1- thioxopropan-2-yl)acetamide (ligand 4)
PDB Compounds: (G:) Elongin-B

SCOPe Domain Sequences for d6fmkg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fmkg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d6fmkg_:

Click to download the PDB-style file with coordinates for d6fmkg_.
(The format of our PDB-style files is described here.)

Timeline for d6fmkg_: