Lineage for d1idea_ (1ide A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2155664Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2155665Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2155666Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2155728Protein Isocitrate dehydrogenase, ICDH [53668] (2 species)
  7. 2155732Species Escherichia coli [TaxId:562] [53669] (27 PDB entries)
  8. 2155756Domain d1idea_: 1ide A: [35082]
    complexed with ict, mg, nap; mutant

Details for d1idea_

PDB Entry: 1ide (more details), 2.5 Å

PDB Description: isocitrate dehydrogenase y160f mutant steady-state intermediate complex (laue determination)
PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d1idea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1idea_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]}
skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel
dlyiclrpvryyqgtpspvkhpeltdmvifrensedifagiewkadsadaekvikflree
mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

SCOPe Domain Coordinates for d1idea_:

Click to download the PDB-style file with coordinates for d1idea_.
(The format of our PDB-style files is described here.)

Timeline for d1idea_: