SCOPe 2.08: Domain d6cckb1: 6cck B:1-159

Lineage for d6cckb1 (6cck B:1-159)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein Phosphopantetheine adenylyltransferase [52398] (7 species)

7. Species Escherichia coli [TaxId:562] [52399] (10 PDB entries)

8. Domain d6cckb1: 6cck B:1-159 [350781]
   Other proteins in same PDB: d6cckb2
   automated match to d1gn8a_
   complexed with atp, exj, mg, so4

Details for d6cckb1

PDB Entry: 6cck, 1.61 Å

PDB Description: crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with (r)-3-(3-chlorophenyl)-3-((5-methyl-7- oxo-4,7-dihydro-[1,2,4]triazolo[1,5-a]pyrimidin-2-yl)amino) propanenitrile

PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6cckb1:

Sequence; same for both SEQRES and ATOM records:

>d6cckb1 c.26.1.3 (B:1-159) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]}
mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
skewsfissslvkevarhqgdvthflpenvhqalmakla

Timeline for d6cckb1:

• d6cckb1 first appeared in SCOPe 2.07