Lineage for d1gn8a_ (1gn8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860491Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2860494Species Escherichia coli [TaxId:562] [52399] (10 PDB entries)
  8. 2860505Domain d1gn8a_: 1gn8 A: [65395]
    complexed with atp, mn, so4

Details for d1gn8a_

PDB Entry: 1gn8 (more details), 1.83 Å

PDB Description: phosphopantetheine adenylyltransferase in complex with mn2+atp from escherichia coli
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d1gn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gn8a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]}
mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
skewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d1gn8a_:

Click to download the PDB-style file with coordinates for d1gn8a_.
(The format of our PDB-style files is described here.)

Timeline for d1gn8a_: