Lineage for d1hj6a_ (1hj6 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1619978Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1619979Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1619980Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1620039Protein Isocitrate dehydrogenase, ICDH [53668] (2 species)
  7. 1620043Species Escherichia coli [TaxId:562] [53669] (27 PDB entries)
  8. 1620052Domain d1hj6a_: 1hj6 A: [35070]
    complexed with gol, ipm, mg, nap; mutant

Details for d1hj6a_

PDB Entry: 1hj6 (more details), 2 Å

PDB Description: isocitrate dehydrogenase s113e mutant complexed with isopropylmalate, nadp+ and magnesium (flash-cooled)
PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d1hj6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hj6a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]}
skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirelnvalrqel
dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

SCOPe Domain Coordinates for d1hj6a_:

Click to download the PDB-style file with coordinates for d1hj6a_.
(The format of our PDB-style files is described here.)

Timeline for d1hj6a_: