SCOPe 2.07: Domain d6fe4c1: 6fe4 C:20-89

Lineage for d6fe4c1 (6fe4 C:20-89)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein automated matches [190381] (11 species)
   not a true protein

7. Species Enterobacteria phage [TaxId:10730] [350541] (1 PDB entry)

8. Domain d6fe4c1: 6fe4 C:20-89 [350695]
   Other proteins in same PDB: d6fe4a2, d6fe4b2, d6fe4c2, d6fe4e2, d6fe4f1, d6fe4f2, d6fe4g1, d6fe4g2, d6fe4h1, d6fe4h2, d6fe4i1, d6fe4i2, d6fe4j1, d6fe4j2
   automated match to d2ga4b_

Details for d6fe4c1

PDB Entry: 6fe4, 3 Å

PDB Description: crystal structure of the complex between shiga toxin stx2 b subunit and neutralising nb113

PDB Compounds: (C:) Shiga-like toxin 2 subunit B

SCOPe Domain Sequences for d6fe4c1:

Sequence; same for both SEQRES and ATOM records:

>d6fe4c1 b.40.2.1 (C:20-89) automated matches {Enterobacteria phage [TaxId: 10730]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd

Timeline for d6fe4c1:

• d6fe4c1 is new in SCOPe 2.07-stable
  
• d6fe4c1 appears in the current release, SCOPe 2.08