Lineage for d1cw4a_ (1cw4 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 591543Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 591544Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) (S)
    the constituent families form similar dimers
  5. 591545Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
    the active site is between the two identical subunits
  6. 591595Protein Isocitrate dehydrogenase, ICDH [53668] (2 species)
  7. 591599Species Escherichia coli [TaxId:562] [53669] (26 PDB entries)
  8. 591605Domain d1cw4a_: 1cw4 A: [35068]
    complexed with akg, mn, so4; mutant

Details for d1cw4a_

PDB Entry: 1cw4 (more details), 2.1 Å

PDB Description: crystal structure of k230m isocitrate dehydrogenase in complex with alpha-ketoglutarate

SCOP Domain Sequences for d1cw4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cw4a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli}
eskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykger
kiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqe
ldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflre
emgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhmgnimkftegaf
kdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviac
mnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsae
mmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

SCOP Domain Coordinates for d1cw4a_:

Click to download the PDB-style file with coordinates for d1cw4a_.
(The format of our PDB-style files is described here.)

Timeline for d1cw4a_: