| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) ![]() Pfam PF13853. Phylogeny described in PubMed 12761335 |
| Family f.13.1.2: Rhodopsin-like [81320] (2 proteins) Individual TM segments have a number of kinks and distortions |
| Protein automated matches [190300] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [188510] (18 PDB entries) |
| Domain d6fk9a_: 6fk9 A: [350636] automated match to d1l9ha_ complexed with bma, bog, dnk, man, nag, plm |
PDB Entry: 6fk9 (more details), 2.63 Å
SCOPe Domain Sequences for d6fk9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fk9a_ f.13.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mcgtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
attqkaekevtrmviimviaflicwlpyagvafyifthqgscfgpifmtipaffaktsav
ynpviyimmnkqfrncmvttlccgkn
Timeline for d6fk9a_: