Lineage for d1cnza_ (1cnz A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708456Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 708457Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) (S)
    the constituent families form similar dimers
  5. 708458Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
    the active site is between the two identical subunits
  6. 708459Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (9 species)
  7. 708480Species Salmonella typhimurium [TaxId:90371] [53666] (1 PDB entry)
  8. 708481Domain d1cnza_: 1cnz A: [35061]

Details for d1cnza_

PDB Entry: 1cnz (more details), 1.76 Å

PDB Description: 3-isopropylmalate dehydrogenase (ipmdh) from salmonella typhimurium
PDB Compounds: (A:) protein (3-isopropylmalate dehydrogenase)

SCOP Domain Sequences for d1cnza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 602]}
msknyhiavlpgdgigpevmaqalkvmdavrsrfdmrittshydvggiaidnhghplpka
tvegceqadailfgsvggpkwenlppesqpergallplrkhfklfsnlrpaklyqgleaf
cplradiaangfdilcvreltggiyfgqpkgregsgqyekafdtevyhrfeieriariaf
esarkrrrkvtsidkanvlqssilwreivndvaktypdvelahmyidnatmqlikdpsqf
dvllcsnlfgdilsdecamitgsmgmlpsaslneqgfglyepaggsapdiagknianpia
qilslalllrysldandaataieqainraleegvrtgdlargaaavstdemgdiiaryva
egv

SCOP Domain Coordinates for d1cnza_:

Click to download the PDB-style file with coordinates for d1cnza_.
(The format of our PDB-style files is described here.)

Timeline for d1cnza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cnzb_