Lineage for d1cnza_ (1cnz A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27255Fold c.77: Isocitrate & isopropylmalate dehydrogenases [53658] (1 superfamily)
  4. 27256Superfamily c.77.1: Isocitrate & isopropylmalate dehydrogenases [53659] (1 family) (S)
  5. 27257Family c.77.1.1: Isocitrate & isopropylmalate dehydrogenases [53660] (2 proteins)
  6. 27258Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (6 species)
  7. 27268Species Salmonella typhimurium [TaxId:90371] [53666] (1 PDB entry)
  8. 27269Domain d1cnza_: 1cnz A: [35061]

Details for d1cnza_

PDB Entry: 1cnz (more details), 1.76 Å

PDB Description: 3-isopropylmalate dehydrogenase (ipmdh) from salmonella typhimurium

SCOP Domain Sequences for d1cnza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium}
msknyhiavlpgdgigpevmaqalkvmdavrsrfdmrittshydvggiaidnhghplpka
tvegceqadailfgsvggpkwenlppesqpergallplrkhfklfsnlrpaklyqgleaf
cplradiaangfdilcvreltggiyfgqpkgregsgqyekafdtevyhrfeieriariaf
esarkrrrkvtsidkanvlqssilwreivndvaktypdvelahmyidnatmqlikdpsqf
dvllcsnlfgdilsdecamitgsmgmlpsaslneqgfglyepaggsapdiagknianpia
qilslalllrysldandaataieqainraleegvrtgdlargaaavstdemgdiiaryva
egv

SCOP Domain Coordinates for d1cnza_:

Click to download the PDB-style file with coordinates for d1cnza_.
(The format of our PDB-style files is described here.)

Timeline for d1cnza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cnzb_