SCOP 1.75: Domain d1gc8a_: 1gc8 A:

Lineage for d1gc8a_ (1gc8 A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
   the active site is between the two identical subunits

6. Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (9 species)

7. Species Thermus thermophilus [TaxId:274] [53662] (14 PDB entries)

8. Domain d1gc8a_: 1gc8 A: [35042]

Details for d1gc8a_

PDB Entry: 1gc8, 2.5 Å

PDB Description: the crystal structure of thermus thermophilus 3-isopropylmalate dehydrogenase mutated at 172th from ala to phe

PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOP Domain Sequences for d1gc8a_:

Sequence; same for both SEQRES and ATOM records:

>d1gc8a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus [TaxId: 274]}
mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafefarkrrkhv
vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
afglvelarkvedavakalletpppdlggsagteaftatvlrhla

Timeline for d1gc8a_:

• d1gc8a_ first appeared (with stable ids) in SCOP 1.55
  
• d1gc8a_ appears in SCOP 1.73
  
• d1gc8a_ appears in SCOPe 2.01
  
• d1gc8a_ appears in the current release, SCOPe 2.08