SCOPe 2.07: Domain d6cu5a_: 6cu5 A:

Lineage for d6cu5a_ (6cu5 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (81 species)
   not a true protein

7. Species Naegleria fowleri [TaxId:5763] [350234] (2 PDB entries)

8. Domain d6cu5a_: 6cu5 A: [350251]
   automated match to d1oria_
   complexed with sah

Details for d6cu5a_

PDB Entry: 6cu5, 2.7 Å

PDB Description: crystal structure of a protein arginine n-methyltransferase from naegleria fowleri bound to sah

PDB Compounds: (A:) protein arginine N-methyltransferase

SCOPe Domain Sequences for d6cu5a_:

Sequence; same for both SEQRES and ATOM records:

>d6cu5a_ c.66.1.0 (A:) automated matches {Naegleria fowleri [TaxId: 5763]}
tgiheemlkdgirtnayknailqnkhlfkdkvvldigcgtgilclfaakagakrvigidm
sdiidkarqivsdngyshvielikgkvediaqlpfgiekvdiiisewmgyfllyesmlqt
vlsardrwlrpggylfpdkctmyicgiedseykrdkidfwdnvygfnfsaikadalrepl
vdfvesqqiittqskfleidlntiqpedlkqittsfeftsqyqeycqafvawfdcvfsrg
phkpvefstgpftegthwkqtvfylendlplkpndvikgtitisqnksnhrdldismkyt
vnggavisqdyimr

Timeline for d6cu5a_:

• d6cu5a_ is new in SCOPe 2.07-stable
  
• d6cu5a_ appears in the current release, SCOPe 2.08