Lineage for d6bv0a4 (6bv0 A:634-963)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2339141Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2339142Protein automated matches [190220] (14 species)
    not a true protein
  7. 2339284Species Pig (Sus scrofa) [TaxId:9823] [311380] (18 PDB entries)
  8. 2339294Domain d6bv0a4: 6bv0 A:634-963 [350153]
    Other proteins in same PDB: d6bv0a1, d6bv0a2, d6bv0a3, d6bv0a5
    automated match to d4fkea4
    complexed with arg, nag, so4, zn

Details for d6bv0a4

PDB Entry: 6bv0 (more details), 1.86 Å

PDB Description: crystal structure of porcine aminopeptidase-n with arginine
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d6bv0a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bv0a4 a.118.1.0 (A:634-963) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
dnwrmiqhqlqtnlsvipvinraqviydsfnlatahmvpvtlaldntlflngekeympwq
aalsslsyfslmfdrsevygpmkkylrkqveplfqhfetltknwterpenlmdqyseina
istacsnglpqcenlaktlfdqwmsdpennpihpnlrstiycnaiaqggqdqwdfawgql
qqaqlvneadklrsalacsnevwllnrylgytlnpdlirkqdatstinsiasnvigqpla
wdfvqsnwkklfqdygggsfsfsnliqgvtrrfssefelqqleqfkknnmdvgfgsgtra
leqalektkanikwvkenkevvlnwfiehs

SCOPe Domain Coordinates for d6bv0a4:

Click to download the PDB-style file with coordinates for d6bv0a4.
(The format of our PDB-style files is described here.)

Timeline for d6bv0a4: