Lineage for d6c46a1 (6c46 A:1-181)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424649Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2424650Protein automated matches [190388] (31 species)
    not a true protein
  7. 2424689Species Elizabethkingia anophelis [TaxId:1338011] [350033] (1 PDB entry)
  8. 2424690Domain d6c46a1: 6c46 A:1-181 [350058]
    Other proteins in same PDB: d6c46a2, d6c46b2, d6c46c2, d6c46d2, d6c46e2
    automated match to d2ixka_
    complexed with ca

Details for d6c46a1

PDB Entry: 6c46 (more details), 1.95 Å

PDB Description: crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1
PDB Compounds: (A:) dtdp-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d6c46a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c46a1 b.82.1.0 (A:1-181) automated matches {Elizabethkingia anophelis [TaxId: 1338011]}
mklvktplkdcyiieptvfedergyfyekynekkfeeltglnghfvqdniskssygvlrg
lhlqkgkhaqaklvsclegrvwdvavdlrensetfgkcygmelsaenklqfyvprgfahg
fvvlsetavfsykcdnfynkesegsvkfndsdlsidwkipeadmilsekdqnapafkdkn
y

SCOPe Domain Coordinates for d6c46a1:

Click to download the PDB-style file with coordinates for d6c46a1.
(The format of our PDB-style files is described here.)

Timeline for d6c46a1: