SCOPe 2.07: Domain d6bx5c_: 6bx5 C:

Lineage for d6bx5c_ (6bx5 C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (68 PDB entries)

8. Domain d6bx5c_: 6bx5 C: [349821]
   automated match to d3uyod_
   complexed with f, na

Details for d6bx5c_

PDB Entry: 6bx5, 3 Å

PDB Description: the crystal structure of fluoride channel fluc ec2 with monobody s12

PDB Compounds: (C:) Monobody S12

SCOPe Domain Sequences for d6bx5c_:

Sequence; same for both SEQRES and ATOM records:

>d6bx5c_ b.1.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svssvptklevvaatptslliswdapavtvifyvitygetggnspvqeftvpgskstati
sglkpgvdytitvyatyyasnsgwyeygspisinyrt

Timeline for d6bx5c_:

• d6bx5c_ is new in SCOPe 2.07-stable
  
• d6bx5c_ appears in the current release, SCOPe 2.08