SCOPe 2.07: Domain d5x2ja2: 5x2j A:91-199

Lineage for d5x2ja2 (5x2j A:91-199)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (37 species)
   not a true protein

7. Species Staphylococcus equorum [TaxId:246432] [349736] (3 PDB entries)

8. Domain d5x2ja2: 5x2j A:91-199 [349737]
   Other proteins in same PDB: d5x2ja1
   automated match to d1xrea2
   complexed with mn

Details for d5x2ja2

PDB Entry: 5x2j, 1.4 Å

PDB Description: crystal structure of a recombinant hybrid manganese superoxide dismutase from staphylococcus equorum and staphylococcus saprophyticus

PDB Compounds: (A:) manganese superoxide dismutase

SCOPe Domain Sequences for d5x2ja2:

Sequence; same for both SEQRES and ATOM records:

>d5x2ja2 d.44.1.0 (A:91-199) automated matches {Staphylococcus equorum [TaxId: 246432]}
nseekgtvvdkikeqwgsldafkeefanqaaarfgsgwawlvvndgkleivttpnqdnpl
tegktpilgldvwehayylkyqnkrpdyisafwnvvnwekvdelynaak

Timeline for d5x2ja2:

• d5x2ja2 is new in SCOPe 2.07-stable
  
• d5x2ja2 appears in the current release, SCOPe 2.08