Lineage for d6b5eb_ (6b5e B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2505843Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2505844Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2506034Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 2506165Protein automated matches [191218] (6 species)
    not a true protein
  7. 2506181Species Mycobacterium tuberculosis [TaxId:83332] [349397] (2 PDB entries)
  8. 2506185Domain d6b5eb_: 6b5e B: [349656]
    automated match to d4ho4a_
    complexed with cl, dau, edo, mg, na, tyd

Details for d6b5eb_

PDB Entry: 6b5e (more details), 1.85 Å

PDB Description: mycobacterium tuberculosis rmla in complex with dtdp-glucose
PDB Compounds: (B:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d6b5eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b5eb_ c.68.1.6 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mrgiilaggsgtrlypitmgiskqllpvydkpmiyyplttlmmagirdiqlittphdapg
fhrllgdgahlgvnisyatqdqpdglaqafviganhigadsvalvlgdnifygpglgtsl
krfqsisggaifaywvanpsaygvvefgaegmalsleekpvtpksnyavpglyfydndvi
eiarglkksargeyeitevnqvylnqgrlavevlargtawldtgtfdslldaadfvrtle
rrqglkvsipeevawrmgwiddeqlvqraralvksgygnyllelle

SCOPe Domain Coordinates for d6b5eb_:

Click to download the PDB-style file with coordinates for d6b5eb_.
(The format of our PDB-style files is described here.)

Timeline for d6b5eb_: