Lineage for d1e0da3 (1e0d A:94-297)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74156Fold c.72: Ribokinase-like [53612] (2 superfamilies)
  4. 74197Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families) (S)
  5. 74198Family c.72.2.1: MurD/MurE/MurF [53624] (3 proteins)
  6. 74203Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53625] (1 species)
  7. 74204Species Escherichia coli [TaxId:562] [53626] (6 PDB entries)
  8. 74210Domain d1e0da3: 1e0d A:94-297 [34959]
    Other proteins in same PDB: d1e0da1, d1e0da2

Details for d1e0da3

PDB Entry: 1e0d (more details), 2.4 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOP Domain Sequences for d1e0da3:

Sequence, based on SEQRES records: (download)

>d1e0da3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpirgadercvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnal
aalaladaaglprasslkalttft

Sequence, based on observed residues (ATOM records): (download)

>d1e0da3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedfglqqyraaklriyenakvcvvnaddaltmp
iadercvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnalaalalada
aglprasslkalttft

SCOP Domain Coordinates for d1e0da3:

Click to download the PDB-style file with coordinates for d1e0da3.
(The format of our PDB-style files is described here.)

Timeline for d1e0da3: