SCOPe 2.07: Domain d6b30b_: 6b30 B:

Lineage for d6b30b_ (6b30 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (104 PDB entries)

8. Domain d6b30b_: 6b30 B: [349561]
   automated match to d5ufra_
   complexed with cfg

Details for d6b30b_

PDB Entry: 6b30, 2.69 Å

PDB Description: structure of rorgt in complex with a novel inverse agonist 1

PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d6b30b_:

Sequence; same for both SEQRES and ATOM records:

>d6b30b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslc

Timeline for d6b30b_:

• d6b30b_ is new in SCOPe 2.07-stable
  
• d6b30b_ appears in the current release, SCOPe 2.08