Lineage for d3uaga3 (3uag A:94-297)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 591165Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 591296Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families) (S)
    has extra strand located between strands 1 and 2
  5. 591297Family c.72.2.1: MurCDEF [53624] (4 proteins)
  6. 591314Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53625] (1 species)
  7. 591315Species Escherichia coli [TaxId:562] [53626] (6 PDB entries)
  8. 591318Domain d3uaga3: 3uag A:94-297 [34956]
    Other proteins in same PDB: d3uaga1, d3uaga2
    complexed with adp, epe, mn, uma

Details for d3uaga3

PDB Entry: 3uag (more details), 1.77 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOP Domain Sequences for d3uaga3:

Sequence, based on SEQRES records: (download)

>d3uaga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpirgadercvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnal
aalaladaaglprasslkalttft

Sequence, based on observed residues (ATOM records): (download)

>d3uaga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpiercvsfgvnmgdyhlnhetwlrvkgekvlnvkemklsgqhnytnalaalalad
aaglprasslkalttft

SCOP Domain Coordinates for d3uaga3:

Click to download the PDB-style file with coordinates for d3uaga3.
(The format of our PDB-style files is described here.)

Timeline for d3uaga3: