Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (40 species) not a true protein |
Species Aspergillus niger [TaxId:5061] [348600] (5 PDB entries) |
Domain d5xvic1: 5xvi C:2-187 [349262] automated match to d1bvua2 complexed with gol |
PDB Entry: 5xvi (more details), 2.8 Å
SCOPe Domain Sequences for d5xvic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xvic1 c.58.1.0 (C:2-187) automated matches {Aspergillus niger [TaxId: 5061]} snlphepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvweddagnvq vnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfdp kgksdneirrfcvsfmtelckhigadtdvpagdigvtgrevgflfgqyrkirnqwegvlt gkggsw
Timeline for d5xvic1: