SCOPe 2.07: Domain d6aq7l1: 6aq7 L:1-111

Lineage for d6aq7l1 (6aq7 L:1-111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6aq7l1: 6aq7 L:1-111 [349258]
   Other proteins in same PDB: d6aq7a1, d6aq7a2, d6aq7l2
   automated match to d3i75a1
   complexed with gol, tce

Details for d6aq7l1

PDB Entry: 6aq7, 1.83 Å

PDB Description: structure of pom6 fab fragment complexed with mouse prpc

PDB Compounds: (L:) POM6 FAB light CHAIN

SCOPe Domain Sequences for d6aq7l1:

Sequence; same for both SEQRES and ATOM records:

>d6aq7l1 b.1.1.0 (L:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspavlatsngeratitckasmsvststysymdwyqqkpgqppkllikkasnnet
gvparfsgsgtkkdftltihpvqqedvstyycqhswqtpltfgagtvlelk

Timeline for d6aq7l1:

• d6aq7l1 is new in SCOPe 2.07-stable
  
• d6aq7l1 appears in the current release, SCOPe 2.08