Lineage for d6aowb_ (6aow B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377239Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2377642Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2377643Protein automated matches [190503] (10 species)
    not a true protein
  7. 2377649Species Escherichia coli [TaxId:364106] [349115] (10 PDB entries)
  8. 2377659Domain d6aowb_: 6aow B: [349119]
    automated match to d4xocb_
    complexed with so4

Details for d6aowb_

PDB Entry: 6aow (more details), 1.6 Å

PDB Description: crystal structure of lectin domain of f9 pilus adhesin fmlh from e. coli uti89
PDB Compounds: (B:) F9 pilus adhesin FmlH

SCOPe Domain Sequences for d6aowb_:

Sequence, based on SEQRES records: (download)

>d6aowb_ b.2.3.0 (B:) automated matches {Escherichia coli [TaxId: 364106]}
fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgaaggvvik
ageviarihmykiatlgsgnprnftwniisnnsvvm

Sequence, based on observed residues (ATOM records): (download)

>d6aowb_ b.2.3.0 (B:) automated matches {Escherichia coli [TaxId: 364106]}
fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitgvvikagevia
rihmykiatlgsgnprnftwniisnnsvvm

SCOPe Domain Coordinates for d6aowb_:

Click to download the PDB-style file with coordinates for d6aowb_.
(The format of our PDB-style files is described here.)

Timeline for d6aowb_: