Class b: All beta proteins [48724] (178 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.0: automated matches [191391] (1 protein) not a true family |
Protein automated matches [190503] (10 species) not a true protein |
Species Escherichia coli [TaxId:364106] [349115] (10 PDB entries) |
Domain d6aowb_: 6aow B: [349119] automated match to d4xocb_ complexed with so4 |
PDB Entry: 6aow (more details), 1.6 Å
SCOPe Domain Sequences for d6aowb_:
Sequence, based on SEQRES records: (download)
>d6aowb_ b.2.3.0 (B:) automated matches {Escherichia coli [TaxId: 364106]} fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgaaggvvik ageviarihmykiatlgsgnprnftwniisnnsvvm
>d6aowb_ b.2.3.0 (B:) automated matches {Escherichia coli [TaxId: 364106]} fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitgvvikagevia rihmykiatlgsgnprnftwniisnnsvvm
Timeline for d6aowb_: