Lineage for d1dr1__ (1dr1 -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 401379Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 401380Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 401381Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 401480Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species)
  7. 401481Species Chicken (Gallus gallus) [TaxId:9031] [53606] (8 PDB entries)
  8. 401483Domain d1dr1__: 1dr1 - [34896]
    complexed with bio, ca, nap

Details for d1dr1__

PDB Entry: 1dr1 (more details), 2.2 Å

PDB Description: 2.2 angstroms crystal structure of chicken liver dihydrofolate reductase complexed with nadp+ and biopterin

SCOP Domain Sequences for d1dr1__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dr1__ c.71.1.1 (-) Dihydrofolate reductases, eukaryotic type {Chicken (Gallus gallus)}
vrslnsivavcqnmgigkdgnlpwpplrneykyfqrmtstshvegkqnavimgkktwfsi
peknrplkdrinivlsrelkeapkgahylskslddalalldspelkskvdmvwivggtav
ykaamekpinhrlfvtrilhefesdtffpeidykdfkllteypgvpadiqeedgiqykfe
vyqksv

SCOP Domain Coordinates for d1dr1__:

Click to download the PDB-style file with coordinates for d1dr1__.
(The format of our PDB-style files is described here.)

Timeline for d1dr1__: