Lineage for d1dr1a_ (1dr1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903757Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2903770Species Chicken (Gallus gallus) [TaxId:9031] [53606] (8 PDB entries)
  8. 2903772Domain d1dr1a_: 1dr1 A: [34896]
    complexed with ca, hbi, nap

Details for d1dr1a_

PDB Entry: 1dr1 (more details), 2.2 Å

PDB Description: 2.2 angstroms crystal structure of chicken liver dihydrofolate reductase complexed with nadp+ and biopterin
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1dr1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dr1a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Chicken (Gallus gallus) [TaxId: 9031]}
vrslnsivavcqnmgigkdgnlpwpplrneykyfqrmtstshvegkqnavimgkktwfsi
peknrplkdrinivlsrelkeapkgahylskslddalalldspelkskvdmvwivggtav
ykaamekpinhrlfvtrilhefesdtffpeidykdfkllteypgvpadiqeedgiqykfe
vyqksv

SCOPe Domain Coordinates for d1dr1a_:

Click to download the PDB-style file with coordinates for d1dr1a_.
(The format of our PDB-style files is described here.)

Timeline for d1dr1a_: