Lineage for d1cz3b_ (1cz3 B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 707730Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 707731Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families) (S)
  5. 707732Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 707752Protein Dihydrofolate reductase, prokaryotic type [53599] (6 species)
  7. 707837Species Thermotoga maritima [TaxId:2336] [53603] (2 PDB entries)
  8. 707839Domain d1cz3b_: 1cz3 B: [34892]
    complexed with so4

Details for d1cz3b_

PDB Entry: 1cz3 (more details), 2.1 Å

PDB Description: dihydrofolate reductase from thermotoga maritima
PDB Compounds: (B:) dihydrofolate reductase

SCOP Domain Sequences for d1cz3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cz3b_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima [TaxId: 2336]}
akvifvlamdvsgkiassveswssfedrknfrkitteignvvmgritfeeigrplperln
vvltrrpktsnnpslvffngspadvvkflegkgyervaviggktvfteflreklvdelfv
tvepyvfgkgipffdefegyfplkllemrrlnergtlflkysvekshr

SCOP Domain Coordinates for d1cz3b_:

Click to download the PDB-style file with coordinates for d1cz3b_.
(The format of our PDB-style files is described here.)

Timeline for d1cz3b_: