SCOPe 2.07: Domain d5yjia_: 5yji A:

Lineage for d5yjia_ (5yji A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (81 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187843] (21 PDB entries)

8. Domain d5yjia_: 5yji A: [348878]
   automated match to d2i62b_
   complexed with 8wo, sah

Details for d5yjia_

PDB Entry: 5yji, 1.99 Å

PDB Description: co-crystal structure of mouse nicotinamide n-methyltransferase (nnmt) with small molecule analog of nicotinamide

PDB Compounds: (A:) Nicotinamide N-methyltransferase

SCOPe Domain Sequences for d5yjia_:

Sequence; same for both SEQRES and ATOM records:

>d5yjia_ c.66.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ftskdtylshfnprdylekyysfgsrhcaeneilrhllknlfkifclgavkgellidigs
gptiyqllsacesfteiivsdytdqnlwelqkwlkkepgafdwspvvtyvcdlegnrmkg
pekeeklrraikqvlkcdvtqsqplggvslppadcllstlcldaacpdlpayrtalrnlg
sllkpggflvmvdalkssyymigeqkfsslplgwetvrdaveeagytieqfevisqnyss
ttsnneglfslvgrkp

Timeline for d5yjia_:

• d5yjia_ is new in SCOPe 2.07-stable
  
• d5yjia_ appears in the current release, SCOPe 2.08