![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein automated matches [190057] (27 species) not a true protein |
![]() | Species Bacillus sp. [TaxId:65673] [187690] (11 PDB entries) |
![]() | Domain d5xc1a_: 5xc1 A: [348755] automated match to d5effa_ complexed with mg, na, pgo; mutant |
PDB Entry: 5xc1 (more details), 2.26 Å
SCOPe Domain Sequences for d5xc1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xc1a_ c.1.8.3 (A:) automated matches {Bacillus sp. [TaxId: 65673]} vqpfaaqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpee gvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqanke lllerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvafe tarkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptide irtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelyee ldadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid
Timeline for d5xc1a_: