SCOP 1.63: Domain d1rx7__: 1rx7 -

Lineage for d1rx7__ (1rx7 -)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)

7. Species Escherichia coli [TaxId:562] [53600] (42 PDB entries)

8. Domain d1rx7__: 1rx7 - [34868]
   complexed with fol

Details for d1rx7__

PDB Entry: 1rx7, 2.3 Å

PDB Description: structure of dihydrofolate reductase complexed with folate

SCOP Domain Sequences for d1rx7__:

Sequence; same for both SEQRES and ATOM records:

>d1rx7__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d1rx7__:

• d1rx7__ first appeared (with stable ids) in SCOP 1.55
  
• d1rx7__ appears in SCOP 1.61
  
• d1rx7__ appears in SCOP 1.65
  
• d1rx7__ appears in the current release, SCOPe 2.08, called d1rx7a_