Lineage for d5xgoa_ (5xgo A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2315615Species Escherichia coli [TaxId:83333] [348468] (2 PDB entries)
  8. 2315616Domain d5xgoa_: 5xgo A: [348489]
    automated match to d1veia_
    complexed with cl

Details for d5xgoa_

PDB Entry: 5xgo (more details), 1.99 Å

PDB Description: the ferritin e-domain: toward understanding its role in protein cage assembly through the crystal structure of a maxi-/mini-ferritin chimera
PDB Compounds: (A:) DNA protection during starvation protein,Bacterioferritin

SCOPe Domain Sequences for d5xgoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xgoa_ a.25.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiecnldl

SCOPe Domain Coordinates for d5xgoa_:

Click to download the PDB-style file with coordinates for d5xgoa_.
(The format of our PDB-style files is described here.)

Timeline for d5xgoa_: