Lineage for d1rx2__ (1rx2 -)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) 
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) 
Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species) Species Escherichia coli [TaxId:562] [53600] (42 PDB entries) 
Domain d1rx2__: 1rx2 - [34836]
Details for d1rx2__
PDB Entry: 1rx2 (more details), 1.8 Å
PDB Description: dihydrofolate reductase (e.c.1.5.1.3) complexed with with folate and nicotinamide adenine dinucleotide phosphate (oxidized form)
SCOP Domain Sequences for d1rx2__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rx2__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
SCOP Domain Coordinates for d1rx2__:
Click to download the PDB-style file with coordinates for d1rx2__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rx2__:
- d1rx2__ first appeared (with stable ids) in SCOP 1.55
- d1rx2__ appears in SCOP 1.59
- d1rx2__ appears in SCOP 1.63
- d1rx2__ appears in the current release, SCOPe 2.08, called d1rx2a_
View in 3D