Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Serratia marcescens [TaxId:615] [348247] (5 PDB entries) |
Domain d5wulb_: 5wul B: [348248] automated match to d4za2a_ |
PDB Entry: 5wul (more details), 1.87 Å
SCOPe Domain Sequences for d5wulb_:
Sequence, based on SEQRES records: (download)
>d5wulb_ c.2.1.0 (B:) automated matches {Serratia marcescens [TaxId: 615]} hplqgkvafvqggsrgigaaivkrlasegaavaftyaasadraeavasavttaggkvlai kadsadaaalqqavrqavshfgnldilvnnagvatlggteelalddldrmlavnvrsvfv asqeaarhmndggriihigstnaervpfggaavyamsksalvgltkgmardlgprsitvn nvqpgpvdtemnpdageladqlkqlmaigrygkdeeiagfvaylagpqagyitgaslsid ggfsa
>d5wulb_ c.2.1.0 (B:) automated matches {Serratia marcescens [TaxId: 615]} hplqgkvafvqggsrgigaaivkrlasegaavaftyaasavttaggkvlaikadsadaaa lqqavrqavshfgnldilvnnagvatlggteelalddldrmlavnvrsvfvasqeaarhm ndggriihigstnaervpfggaavyamsksalvgltkgmardlgprsitvnnvqpgpvlm aigrygkdeeiagfvaylagpqagyitgaslsidggfsa
Timeline for d5wulb_: