SCOPe 2.07: Domain d4dfra_: 4dfr A:

Lineage for d4dfra_ (4dfr A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)

7. Species Escherichia coli [TaxId:562] [53600] (86 PDB entries)

8. Domain d4dfra_: 4dfr A: [34822]
   complexed with ca, cl, mtx

Details for d4dfra_

PDB Entry: 4dfr, 1.7 Å

PDB Description: crystal structures of escherichia coli and lactobacillus casei dihydrofolate reductase refined at 1.7 angstroms resolution. i. general features and binding of methotrexate

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4dfra_:

Sequence; same for both SEQRES and ATOM records:

>d4dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfkilerr

Timeline for d4dfra_:

• d4dfra_ first appeared (with stable ids) in SCOP 1.55
  
• d4dfra_ appears in SCOPe 2.06
  
• d4dfra_ appears in the current release, SCOPe 2.08